KEGG   Bacillus cereus FRI-35: BCK_07505Help
Entry
BCK_07505         CDS       T02291                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcer00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1501625..1502140)
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFEN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcttacattgcattaggttcaaatattggagaacgttatacgtattta
actgaagcgattcagtttctgaataaaaatccttatatcaaagttgaggatgtttcgtct
gtatatgagacggaaccggttggctatactgaccaaagttgctttttgaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacgcaaaaagtagaaaat
gatctaggaagaaaaagggaaattaggtggggacctaggactatcgaccttgacatttta
ctatataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaaactaa

DBGET integrated database retrieval system