KEGG   Bacillus cereus FRI-35: BCK_08680Help
Entry
BCK_08680         CDS       T02291                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcer00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bcer00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761985..1763274
Genome map
AA seq 429 aa AA seqDB search
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEI
GGRVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLG
PRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGR
TVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYM
ILGAASGGEVTVDNVIPQHLESVTAKLREAGVQVETNDDQITVNGDRRLKVVDIKTLVYP
GFPTDLQQPFTTLLTKAHGTGVVTDTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLL
QGAKVKASDLRAGAALVIAGLMADGITEVTGLEHIDRGYENIVDKLKGLGANIWREQMTK
QEIEEMKNA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgctaattgaaggcggaagagctttaaatggaacaattcgcgtgagtggt
gcaaagaacagcgccgttgcactaattccagcgacaattttagcagatactccagtaact
attggtggtgtccctaatatttcggacgtgaaaatgttaggagacttactagaggaaatt
ggagggagagtgacttatggacaggaggaagagatggtagtcgatccttctaacatggtt
gcaatgcctttaccaaatggaaaagtgaaaaaattgcgtgcttcttattatttaatgggt
gcgatgcttggccgttttaaaaaagctgttattgggcttccaggtggatgtcacttagga
ccgaggccgattgatcagcacattaaagggtttgaagcgttaggtgcacatgttacgaat
gaacaaggtgctatctatttaagagcagatgaactacgaggggcacgtatttatttagat
gttgttagtgtaggagctacgattaatattatgctagcagctgtacgagcgaaaggtaga
actgttattgaaaacgcagcgaaagaaccagagattattgatgtagctacactgttaact
agcatgggagcacgtattaaaggtgctggtacagatgtaatccgaattgatggtgtggat
tcactgcacggttgtcatcatacgatcattccagatcgtattgaagcgggtacgtatatg
attttaggtgctgcgtcaggaggagaagtaacagttgataatgttattcctcagcatttg
gagtcagttaccgcaaaattaagagaagctggtgtccaagttgaaacgaatgatgaccaa
attacagtgaacggtgatagaagattaaaagtcgttgatataaaaacgcttgtatatcca
ggtttcccaacagatttacaacagccgtttacaacgcttttaacaaaggcgcatggaacg
ggtgttgtaacggatacgatttatggcgcacgttttaaacatattgatgaattacgtcgt
atgaatgcgcaaattaaagtagaaggtcggtcagctatcgtaactggtcctgttttatta
caaggtgcaaaagtgaaagcgagtgatttgcgagctggagcagcccttgttattgcagga
ttgatggcggatggaattacagaagtaaccggacttgagcatattgatcgtggctatgaa
aatatagtagacaagcttaaagggcttggtgcaaacatttggcgagaacaaatgacaaag
caagaaattgaagaaatgaagaacgcataa

DBGET integrated database retrieval system