KEGG   Bacillus cereus FRI-35: BCK_08925Help
Entry
BCK_08925         CDS       T02291                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCK_08925
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCK_08925
Enzymes [BR:bcer01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BCK_08925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805159..1806463
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDASKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataaccaagtaacaatcgatgcttctaaagagcta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
cctttattagcacgtaacggtcgtgctcgtattgcacttcctggtggatgtgcaattggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatacgttgagggagaactaaaaggagctaaaatttattta
gacttcccaagcgtgggcgcgacagaaaacattatgtctgcagctacattagcaaaaggg
acaacaatccttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcgatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtc
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcggcaattactggtggagacatcttaattgaaaatgctgtgcctgaacat
ttacgctcaattacagcgaagatggaagaaatgggtgttaaaattattgaggaaaatgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatgga
acaagtatgattacagaaacggtattcgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaatcgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtagcagcaactgatttacgtgctgcagctgcattaatcttagct
ggtttagtatcagaaggttacactcgtgtaactgagttaaaacatcttgaccgtggctat
gtaaacttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcatgcttaa

DBGET integrated database retrieval system