KEGG   Bacillus cereus FRI-35: BCK_08995Help
Entry
BCK_08995         CDS       T02291                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00040  Pentose and glucuronate interconversions
bcer00052  Galactose metabolism
bcer00500  Starch and sucrose metabolism
bcer00520  Amino sugar and nucleotide sugar metabolism
bcer01100  Metabolic pathways
bcer01130  Biosynthesis of antibiotics
Module
bcer_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCK_08995
   00052 Galactose metabolism
    BCK_08995
   00500 Starch and sucrose metabolism
    BCK_08995
   00520 Amino sugar and nucleotide sugar metabolism
    BCK_08995
Enzymes [BR:bcer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCK_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD Smr PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: AFQ09706
Position
1818502..1819383
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQSLLEKGKHEMLEKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPIEKNER
RYQVRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVEKEEVHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcaattattccagctgcgggactggggacaagatttttaccg
gtaacaaaggcaatgccgaaagaaatgttacccattgttgataaaccaacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgttacaggaaaagga
aagcgtgctattgaggatcattttgatcattcctttgaattagagcaaagcttactagaa
aaagggaagcatgagatgctagaaaaagtacaagcttcttcaagaattaatattcattat
ataagacaaaaggaaccgaaaggacttggacatgcggtatggtgcgcgcgtaaatttata
ggaaatgaaccatttgcggtattgcttggtgatgatattgtacaagctgaaacgccatgt
ttacgtcaattgatggatcaatatgaagggacacagtcgtcagttatcggtgtacaaaca
gtacctgaaaatgaaacacatcgttatggtattatcgatccaattgaaaaaaatgaacgt
cgttatcaagtgcgtcaatttgttgaaaagccagcagaaggtacagcaccatctaattta
gcgattatgggtcgttacgtattaacaccagaaatctttatgtttcttgagaatcaacaa
acaggtgctggtggagaaattcaattaacagacgcgattcaacgtttaaatgaaattcaa
cgagtattcgcgtatgatttcgaaggcactcgttacgatgttggggagaagtttggattt
attaagacgacaattgagatggcactacaaaatgaagaattaaatgtagagttaatgaag
tatatgaaagaacttgtagaaaaagaagaggtacattcataa

DBGET integrated database retrieval system