KEGG   Bacillus cereus FRI-35: BCK_09715Help
Entry
BCK_09715         CDS       T02291                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00010  Glycolysis / Gluconeogenesis
bcer00051  Fructose and mannose metabolism
bcer00562  Inositol phosphate metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
bcer01230  Biosynthesis of amino acids
Module
bcer_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcer_M00002  Glycolysis, core module involving three-carbon compounds
bcer_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCK_09715 (tpiA)
   00051 Fructose and mannose metabolism
    BCK_09715 (tpiA)
   00562 Inositol phosphate metabolism
    BCK_09715 (tpiA)
Enzymes [BR:bcer01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCK_09715 (tpiA)
Exosome [BR:bcer04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCK_09715 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCK_09715 (tpiA)
  Exosomal proteins of melanoma cells
   BCK_09715 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFQ09848
Position
1969483..1970238
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaactgaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaggctgtttctcca
gctgctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctggaggcggtaaaatga

DBGET integrated database retrieval system