KEGG   Bacillus cereus FRI-35: BCK_10655Help
Entry
BCK_10655         CDS       T02291                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCK_10655
   00052 Galactose metabolism
    BCK_10655
   00500 Starch and sucrose metabolism
    BCK_10655
   00520 Amino sugar and nucleotide sugar metabolism
    BCK_10655
Enzymes [BR:bcer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCK_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141006..2141887
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLDQQHIGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQANQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gcaacgaaagcgatgccgaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtggatattcac
tatattcgtcaaaaagaaccaaaaggattaggtcatgctgtttggtgtgcgcgtaaattc
attggtgatgagccattcgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagatgaaacacaccgttacggaattatcgatccgttagagcaggaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaccagcaa
catattggtgctggtggcgaaattcagttaacagatgcgattcaaagcttaaacgaaatt
caacgtgtattcgcttacgacttcgaaggaaagcgctacgacgtaggtgaaaagttagga
tttgttcaaacaacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaagcgaatcaataa

DBGET integrated database retrieval system