KEGG   Bacillus cereus FRI-35: BCK_10655Help
Entry
BCK_10655         CDS       T02291                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCK_10655
   00052 Galactose metabolism
    BCK_10655
   00500 Starch and sucrose metabolism
    BCK_10655
   00520 Amino sugar and nucleotide sugar metabolism
    BCK_10655
Enzymes [BR:bcer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCK_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141006..2141887
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLDQQHIGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQANQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gcaacgaaagcgatgccgaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtggatattcac
tatattcgtcaaaaagaaccaaaaggattaggtcatgctgtttggtgtgcgcgtaaattc
attggtgatgagccattcgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagatgaaacacaccgttacggaattatcgatccgttagagcaggaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaccagcaa
catattggtgctggtggcgaaattcagttaacagatgcgattcaaagcttaaacgaaatt
caacgtgtattcgcttacgacttcgaaggaaagcgctacgacgtaggtgaaaagttagga
tttgttcaaacaacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaagcgaatcaataa

DBGET integrated database retrieval system