KEGG   Bacillus cereus FRI-35: BCK_11660Help
Entry
BCK_11660         CDS       T02291                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCK_11660
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCK_11660
Enzymes [BR:bcer01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCK_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2338340..2339746
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFESGRRLNMVPDFAEAVVTGEDVSALTVAY
EEYLQSAKKIGEAIVEGNTVTLQIKGVSAHGSTPEKGENAGLLLANFLTKVALDGKGASF
ATFVAETFIGDIYGEKATIAYKDEVSGPLTVNVGRLSYAKENGGNLGLNVRYPVTTNFEE
TITKLKEYVGTHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIYELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acgcaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagagggcgca
ccattcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaacggaa
ggttttacttctaaaaatttagaagggtatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgacgttgtaccagaaggcgatggctggacgact
cctgcatatagtgcagatattcgtgatggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcttactatgcgatgaaaattgtgaaagaattaggattacct
ctttcaaaacgcgttcgtatgattttaggaacagatgaggaaagtaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaagaaaggtacatatgaacttgtttcatttgagtcaggtcgccgtttaaatatggtt
cctgattttgcagaagcggttgttacaggggaggatgtaagtgcacttacagtagcatat
gaagagtatttacaatctgctaaaaaaataggtgaagcaattgtagaaggtaatacagta
acgttgcaaattaaaggggtttcagctcacggatctactccagagaagggcgagaatgca
ggtttattactggcaaacttcttaacgaaagttgctcttgatggaaaaggggcttcgttt
gcaacatttgtagcagaaacatttattggtgatatttatggtgaaaaggctactatcgct
tataaagatgaggttagtggtccgttaacagtgaatgttggtcgcctttcttatgcgaaa
gaaaatggtggcaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
acgattacaaagttaaaagaatatgtaggtactcatggatttgaagtggcggattattcg
aactctcgcccgcatcatgttgataaagatcatgtattaattcgtacgttgcaacgtgta
tatgaagaacaaacaggtgaaaaagcagagctattagcaattggcggcggtacttacgct
cgttcgttaaaagctggtgttgcatttggcccattgttccctggaaaagaagaacttgcg
catcaaaaagatgagtatattgaaattgaagacttattaaaggcaacagcaatttacgcg
caagcaatttatgaattagcgaagtaa

DBGET integrated database retrieval system