KEGG   Bacillus cereus FRI-35: BCK_13340Help
Entry
BCK_13340         CDS       T02291                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCK_13340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCK_13340
   00620 Pyruvate metabolism
    BCK_13340
   00650 Butanoate metabolism
    BCK_13340
  Lipid metabolism
   00071 Fatty acid degradation
    BCK_13340
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCK_13340
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCK_13340
   00626 Naphthalene degradation
    BCK_13340
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCK_13340
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCK_13340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653248..2655851
Genome map
AA seq 867 aa AA seqDB search
MVVKEKIVNEMQEVKEMIDTLVNNGRKALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKKDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSIAAAKTVYDAAVKAGAPKYCIQWIE
KPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIANDCYFVTEEERSKLEKLVINENT
CAVNSDIVGKSAQYIAKLVGITVPKNTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSVNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSISQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLRKHVNDVKVEVFFEVEPDPSDETVFKGAEMMRS
FQPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGSKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVLANDYTDGLALKAIDLVFKYLPRAFKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSTAEGVESLVKAIIELGKSLNINMSIAGQGVAKDQFEEVVGLLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaaattgtaaatgaaatgcaggaagtaaaagagatgattgatacg
ttagtgaataacggtcgaaaggctttacaagcattagaaagttttacacaagagcaaatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcgaag
ttggctgttgaagaaacaggtcgtggtgtatacgaagataaatgtattaaaaatattttt
gctactgaatatatttggcatagcataaagaaagataaaacagtagggattattcacgaa
gatcctcatgaagaaataatagaaattgcggagcccgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacatcgacaacaatgtttaaagcattaatcgcgataaaaacgaga
aatccaattattttcgcatttcatccttccgcacaaaactgttctattgcagctgcgaaa
acagtatacgatgcagcggtgaaggcgggggcaccaaaatattgtattcagtggattgaa
aagccttctgtcgaagcaacgaaacaattaatgaaccatgaaggtgttgcgcttgttttg
gcaactggaggggctggtatggtgaaatcagcttattctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccatgttatatagagaaatcagcgcatataaaacgagcggtt
aatgatttgattttatctaaaacatttgataatggtatgatttgtgcatcagaacaagca
attattgtagacaaggaaatttatgatgatgtgaaaacagaaatgattgcaaatgattgt
tattttgtaaccgaggaagagagaagtaaattagaaaagcttgttattaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatccgcacagtatattgccaaattagttgga
attactgtacctaaaaatacaaaaatgcttgtagctgaaatacaaggcatcggagccgca
tatccactatctcgtgagaagttaagtccagtattagcttgtgtaaaagcaaattcatta
gaagaaggatttacatattgtgaagaaatgttaaacctcggtggtttaggacattcagca
gttatccattctgtaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgccttattgtaaatgccccttcatcacaaggtggaatcggtgacatatataatggattt
attccatcacttacgcttggctgcggttcctacgggaaaaactcgatttctcaaaacgta
acagcgacgcatttattaaatataaaaaggttggcaaatagaaaaaagaatatgcaatgg
ttcaaattaccaccaaaaatttattttgaaaaacatgcgacagcatatttagcaaatatg
cctaacatttcacgtgcatttattgtaacggatccaggaatggttgagcacggatatgta
gatacggtcacgcattatttacgtaaacatgtaaatgatgtgaaagttgaagttttcttt
gaggttgagccggatccatcagatgaaactgtgtttaaaggtgcagaaatgatgagaagt
tttcagccagatgtaattatcgcacttggtggtggttcagcgatggatgccgcgaaaggg
atgtggcttttctatgagcatccagaaacaacattctatggaattaaacagaagttttta
gatataagaaaacgaacatgtaaatatccggaattaggaagtaaggcgcagtttgttgcc
attccaacaacatctggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccactcgcggattatgaattaacgccagatgtagcaattgtt
gatccacaatttgtaatgacagtaccaccacatgtaacagcagacaccggcatggacgta
ttaacgcatgcaatcgaggcgtatgtgtctgttttagcgaatgactatacagatggatta
gcattaaaggccattgatctcgtatttaaatatttaccaagagcatttaaagatggaaat
gatgaagaagcacgagaaaaaatgcacaatgcttctgcaatcgcaggaatggcatttgca
aatgcttttctaggtattaatcacagcttagcacataaaattggaccagaatttcatatt
ccacatgggcgtgcgaatgcaattcttatgccgcacgtagttcgctataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcactttgtagccgatgaacgctatgca
catattgcgagaatgctcgggcttccagcaagttcgactgcagaaggtgtggaatcactt
gtcaaagcaattattgagctcggaaaaagtttaaatataaatatgagtattgcaggacaa
ggagttgctaaagaccaatttgaagaggttgttggattattagcagaaagagcttttgaa
gatcaatgtacaacagctaatccaaaattacctctcatttcagagctgaaagaaatttat
atgaaagcatataaaggtgagtaa

DBGET integrated database retrieval system