KEGG   Bacillus cereus FRI-35: BCK_13460Help
Entry
BCK_13460         CDS       T02291                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcer00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bcer00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bcer02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2675242..2676627
Genome map
AA seq 461 aa AA seqDB search
MKKFVKKAWPFAVVASLAVTSVATWNFTRSSEVNADESGSNAKIKNVIVLIGDGMGPSYM
TAHRYMKDNPKTFEMESTEFDKHLVGTQKTYPEDEHENITDSASAATAMSAGIKTYNAAI
AVDNDKAEVKTVLEQAKEQGKSTGLVATSEITHATPAAFGAHDISRKNMDAIANDYFDEK
IKGKHKVDVMLGGGVNNFVRKDRNLTEEFKKSGYSYVTDRNQLLNDKNDQILGLFAPGGL
DKMIDRTDKTPSLEEMTNAAIERLNKNKKGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFE
KAFKAAIEFAKKDKNTLVVATADHSTGGLSLGVNGEYNFKVEPIKAAKRTPDFMANEIAK
GANVEETLKKYIDLQLTPEEIKAVNDIAPSKDVTKIDNAIEDIFNKRSFTGWTTGGHTGE
DVNVYAFGPGKYLFSGVQENTNIAKRVFDIVGGGDPNKGRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttgtgaaaaaagcatggccatttgcagttgtggcgtcgttagcagttact
tcggtggcaacatggaattttacacgttctagtgaagtgaatgcagatgagagcggaagc
aatgcaaagattaaaaatgttattgtgttaattggagatggtatgggcccttcatatatg
acggctcatcgttatatgaaagataatccaaaaacattcgagatggaatctacagagttt
gataagcatcttgtaggaacacaaaagacatatccggaagatgaacatgaaaatatcaca
gactctgcctcagcagcaacagctatgtcagcaggaattaagacatataatgcggcaatt
gcagttgataatgataaagcagaagtgaaaactgtccttgaacaagcgaaagagcaaggg
aaatcaacgggactcgttgctacttctgaaattacacatgcaacaccagctgctttcggt
gcgcatgacattagtcgtaaaaatatggacgcaattgcaaatgattattttgatgagaaa
attaaagggaagcataaagtagacgttatgcttggtggtggtgtaaataactttgttaga
aaagatcgtaatcttacagaagagtttaagaaatctggttatagctatgtaacagatcgt
aatcaattgttaaatgataaaaatgatcaaattctaggtttatttgcgccaggcggttta
gataaaatgattgaccgtactgataaaacaccttcattagaagaaatgacaaatgcagca
attgagcgtttaaacaaaaataaaaaaggtttcttcttaatggttgaaggaagtcaaatt
gactgggcaggacacgataatgatatcgttggcgcaatgagtgaaatggaagactttgaa
aaggcatttaaagcagcgatcgagtttgcgaaaaaagataaaaatacgttagtcgttgca
acggcagaccactctacaggtggattatctttaggtgtgaatggtgagtataactttaaa
gtagagccaattaaagctgcaaaacgtacaccagacttcatggcaaacgagattgcaaaa
ggtgcaaacgtagaagaaacattgaaaaagtatattgatttacaattaacaccggaagaa
attaaagcggtaaatgatatagctccttcaaaagatgtaacgaagattgataatgcgatt
gaagatattttcaataagcgttcgtttactggatggacaacaggtggacatacaggtgaa
gatgtaaacgtatatgcatttggccctggtaaatacttgttctctggcgttcaagagaat
acaaatatcgctaagcgtgtctttgatattgttggcggtggcgacccgaataaaggaaga
cgctaa

DBGET integrated database retrieval system