KEGG   Bacillus cereus FRI-35: BCK_13855Help
Entry
BCK_13855         CDS       T02291                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:bcer01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcer00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcer00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bcer00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcer00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bcer00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2748867..2749850
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggc
gaattaaaaagtaagttaatcggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaagaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgtgattgataatgatgcgaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacgcttggc
actggtgttggcggcggtgtaattgccaatggagagattgtacacggcgtaagcggtgct
gctggtgaaatcggacatattacagtcgttacagagaatgctttcccatgtaattgtggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtgcgtgttgctatgcaa
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaaggacgt
atcacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttctagcacgttgaac
ccagagaaaatcgttattggcggaggtgtttctaaagctggagatgcacttttagaacca
attcaacgctattttgagcaatatgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system