KEGG   Bacillus cereus FRI-35: BCK_15380Help
Entry
BCK_15380         CDS       T02291                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00010  Glycolysis / Gluconeogenesis
bcer00020  Citrate cycle (TCA cycle)
bcer00620  Pyruvate metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
Module
bcer_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCK_15380
   00020 Citrate cycle (TCA cycle)
    BCK_15380
   00620 Pyruvate metabolism
    BCK_15380
Enzymes [BR:bcer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCK_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AFQ10974
Position
3011977..3013266
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNE
RVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagaagca
aaagaagaagctcctaaagctgaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatatgctcgtgaaaacggcgtagacattcat
aaagtagctggttctggtaagaacggtcgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaagcggtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcaattgcgaaagcaatggttaactctaaacat
acagctcctcacgtaacattaatggatgaagtagatgtaactgaacttgttgctcaccgt
aagaagttcaaagctgttgcagctgacaaaggtattaaattaacttaccttccatacgtt
gttaaagctttaacatctgcattacgtgaatatccaatgttaaacacttctttagatgat
gcttctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcacaatttct
aacgagatcaatgatcttgctggtaaagcacgtgaaggtcgtttagctcctgctgaaatg
aaaggcgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaaccacccagaagtagcaatccttggtatcggccgtatcgctgagaaaccagtt
gtgaaaaacggtgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggtgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system