KEGG   Bacillus cereus FRI-35: BCK_18405Help
Entry
BCK_18405         CDS       T02291                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00900  Terpenoid backbone biosynthesis
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01130  Biosynthesis of antibiotics
Module
bcer_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCK_18405
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCK_18405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFQ11574
Position
complement(3612344..3613501)
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATK
ELADTLRTRISTNVKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRD
KTREEMNTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHK
ESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGTTPAVLNAANEIANALFLKNETAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYAHQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatctatcggcacatctgcattagat
gtcgtttcagctcatcccgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gagcttcttgagcaacaaatcaaaacgtttcaacctcgcattgtaagcgtcgcgacaaaa
gaattagcagacacgcttcgtacgcgtatttcaaccaacgtaaaaattacatacggaaca
gatggcttaattgcggtagctactcaccctgattcaaatcttgtattaagttccgtcgtt
ggtgtttcaggattactcccaacaattgaagcattaaaagcgaagaaagatattgccatc
gctaataaagaaacgttagttgcagctggtcatattgtaactgaactggccaaacaaaac
ggatgtcgtttaattccagtcgatagcgaacattcagctattttccaatgtttaaacgga
gaaaataataaagaaattgacaaattaatcgttacagcttctggcggtgcattccgtgat
aaaacacgtgaagaaatgaacactctacaagcaaaagatgccttaaagcacccaaactgg
ttaatgggggcaaaattaacgattgattctgccacattaatgaataaaggattcgaagta
atggaagcaagatggctatttgatattccttatgaaaaaattgatgtaatgattcataaa
gaaagtattattcattctttagtagagtttattgatggatcagttattgcgcagctcggt
gctcctgatatgaggatgccgattcaatatgcgtttcactaccctactcggctaccttct
tcctatgaaaaattaaatttattagaaattggtagtttacattttgaaaaaccagattta
gagaagtttccttgtctacaatacgcatatgaatgtggcaaaattggtggtactactcct
gctgtattaaacgcagcaaatgaaattgcgaatgcactattcttaaaaaatgaaactgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagcccatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcacatcaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system