KEGG   Bacillus cereus FRI-35: BCK_18905Help
Entry
BCK_18905         CDS       T02291                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCK_18905
Enzymes [BR:bcer01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BCK_18905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3707986..3708981
Genome map
AA seq 331 aa AA seqDB search
MNLAKFPRKKYTESYTPIEKLNNFSEALGGPTIYFKRDDLLGLTAGGNKTRKLEFLVADA
QAKGADTLITAGGIQSNHCRLTLAAAVKEKMKCILVLEEGLEPEEKPDFNGNYFLYHLLG
AENVIVVRNGADLMEEMHKVAKEVSEKGSTPYVIPVGGSNPTGAMGYVACAQEIMAQSFD
QGIDFSSVVCVSGSGGMHAGLITGFAGTQSNIPVIGINVSRGKAEQEEKVAKLVDETSAH
VGIPNFIPREAVTCFDEYVGPGYALPTPEMVEAVQLLAKTEGILLDPVYTGKAVAGLIDL
IRKGTFKKEDNILFVHSGGSPALYANTSLFV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctaaattcccgagaaaaaaatataccgaatcatatacaccaattgagaaa
ttaaacaatttttctgaggcacttggcgggccgactatttattttaaacgagatgattta
cttggtttaacagctggtggtaataagacgagaaagttagagtttctagttgcggatgca
caggcaaagggtgcagatacgttaattacagctggtggtattcagtcaaaccattgccgc
ctaacactggcagctgcggtaaaagaaaaaatgaaatgtattcttgtattagaagaaggg
cttgagccagaagagaagccagattttaacggaaactatttcttatatcatttactaggt
gctgaaaatgtcattgttgtacgaaacggagcagatcttatggaagagatgcataaagtc
gcgaaagaagttagtgaaaaaggtagtacaccatatgtaattccggtcggtggatcaaat
cctactggcgcaatggggtacgttgcttgtgcgcaagaaattatggcgcaatcatttgac
caaggaattgatttcagttcagtcgtttgcgtaagtggtagcggcggtatgcacgctggt
ttaattactggttttgctggaacacaaagtaacattccagtaatcggcattaacgtaagt
agaggaaaagcagagcaagaagagaaagtagcaaaacttgtagatgaaacgtcagctcac
gttggtattccaaactttatcccgcgcgaagctgttacatgctttgatgaatatgtagga
ccaggttatgcgttaccaacgccggaaatggtggaagcagtgcaattacttgcgaaaaca
gaaggtattttactggatccagtgtatacaggtaaagcagtagcggggctaatcgactta
attagaaaaggtacatttaaaaaagaagacaacattttattcgtacattcaggtggttca
ccagctttatatgcgaatacgtctttatttgtgtaa

DBGET integrated database retrieval system