KEGG   Bacillus cereus FRI-35: BCK_18985Help
Entry
BCK_18985         CDS       T02291                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BCK_18985
  Amino acid metabolism
   00380 Tryptophan metabolism
    BCK_18985
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCK_18985
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BCK_18985
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BCK_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3724027..3727224
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFRMQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETQEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKNSGNQEENDLLSR
MLHVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEDLDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPVEEKLKNHEIKQ
QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSTRGEADASGDFEEQLEQWKESMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELESLLEDGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLIAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNQDEIICFIRTP
QSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNLGEAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgccattcctcagccgaaaacatatggaccgctagggaatctc
ccattaatcgataaagataaaccgaccttatcctttatcaagatagcggaagagtatggt
cccatttttcgaatgcaaactttaagtgatacgatcattgtcgtttctgggcatgaactg
gtagcagaagtctgtgacgaaacacgattcgataaaagtatagagggtgctttagcaaag
gttcgtgcctttgctggagacggattatttacaagtgagactcaagagcctaactggaaa
aaagctcataatattttgatgcctacattcagccaacgggcaatgaaagattaccatgcc
atgatggtcgatattgctgtacaactcgttcaaaaatgggcaagactgaatccgaatgaa
aacgtagatgttccagaggatatgactcgccttacattagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgcgagacccctcatccttttattactagcatg
acccgtgctctagatgaggcaatgcaccaattgcagcggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcaacatgatattcaatccatgttttctttagtagat
aatattattgctgaacgtaaaaatagtgggaatcaggaagaaaatgatttactttcccgt
atgttacatgtgcaggatccggaaactggtgaaaaattagatgatgaaaatattcgtttt
caaattatcacttttttaatagctgggcatgaaacaacaagtggattgttatcttttgca
atctattttttattaaaaaatccagataagttgaaaaaagcctatgaagaagtagaccga
gttttaacagatcccactccaacataccaacaagttatgaaactaaagtatatacgtatg
attttaaatgaatcgctacgtctatggcctactgctccagcattcagtctctatgcaaaa
gaagatacagtgattggtgggaaatatccaattaaaaaaggagaagatcgtatttctgtt
cttattccacagttacatagggataaagacgcgtggggagacaatgtggaagagttccaa
cctgaacgatttgaagatctggataaggttcctcatcatgcttataagccatttggaaat
ggtcaacgagcatgtatcggtatgcagtttgcacttcatgaagccacactcgtaatggga
atgcttcttcaacattttgaattcattgattatgaagactatcagctggacgtaaaacaa
accttaacgctaaagcctggtgattttaaaattaggattgtacctcgaaatcaaactatt
agccatactactgttcttgcgcctgtagaggagaaactgaaaaaccatgaaatcaagcag
caagttcagaagactccttctattattggagccgataatctttcacttcttgttctatat
ggctcggatacaggggtagcagaaggtattgcaagagaactagcagatacagctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaagccgccaagtaatgcaggacag
tttgtgcagtggttggaagaattaaaaccggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagaccataattgggctagtacctatcagcgaataccaagatacattgat
gagcaaatggctcaaaaaggagcaacgagattttctacacgcggagaagcggatgcaagt
ggtgatttcgaggaacagctcgagcaatggaaagaaagtatgtggtctgatgcgatgaag
gcatttggattggaacttaacaaaaacatggagaaagaacgcagtactttgagtctgcaa
tttgtcagccgtcttggaggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atattagaaaatcgtgaacttcaatcatctagcagtgaaagaagcacgcgacatattgag
atatccttgccagaaggcgctacgtataaagaaggagaccaccttggggtgctgccaatt
aatagtgagaaaaatgtcaaccgaattttaaaacgctttggattaaacgggaaggatcaa
gtcatattaagcgcaagtgggcgcagtgtaaatcacatacctttagacagtcctgttcgt
ttatatgaccttcttagttatagtgtagaagtgcaagaagcagccactcgagcacaaata
cgagaaatggtgacattcacagcatgtcctcctcataaaaaggaattggaatcattattg
gaagacggagtttatcatgaacaaatattaaagaaacgtatttcaatgttagatcttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgttttttagaacttcttccggcgctc
aaaccgcgttactattcaatttcaagctctccactcattgcacaggatcgtctgagtatt
acggttggtgttgtgaatgcgcctgcatggagcggggaagggacatatgaaggagttgct
tctaattatttagctcagcgtcataatcaagatgagattatctgtttcattcgaacgcca
caatcaaactttcaattacctgaaaatccagaaaccccaattatcatggttggaccaggt
actggaattgcaccattccgtggattcttacaagcccgtcgcgttcaaaagcaaaaaggt
atgaacttaggagaagcgcacctatactttggttgtcgtcatcctgaaaaggattatctc
tatcgtacagaactagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgcttagaaggacatcctaaaacatatgtacagcatgtaataaaagaagatagaatc
catttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaaa
atggctcctgacgtagaagacaccctttgtcaagcctatcaagaaattcatgaagtcagt
gaacaagaagcaaggaattggttggatcgtctgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system