KEGG   Bacillus cereus FRI-35: BCK_19900Help
Entry
BCK_19900         CDS       T02291                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCK_19900
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCK_19900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCK_19900
Enzymes [BR:bcer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BCK_19900
Exosome [BR:bcer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCK_19900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3899461..3901122
Genome map
AA seq 553 aa AA seqDB search
MSNLGLLMKRLLLVGTIALSMLCTESMMNDYMVGAKVIQVERQPKNVIIMVMDGTSSTAT
TLARLYKGKALALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPTIVSS
PGLKSIKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRKHFDVIAE
QQVYQNIDVVLGGGKAALLPIKRKDGEDLVKVIQNKGYDFIETKEALLKSKSNKMWGSFS
HNALAFDMDREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDPIGMI
SDVLAFDNAVAEALRFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPVSTYIDPLK
KAKMTLEGTINNLKSDISNVEEVAKLYGLDNLTYDEKERLKVVKKKIDVGPIFTTLLANR
ANIGFTTGGHTGEDVFLYSYGPQKPVGLIQNTDVAKTMAKAMGFNLEEVTNKLFVESELA
FKQNGATVTVDNTNAVNPVLIVKRNNVTAQLFVNKNIIRIKNKDYELGSVVVESNGKFYV
PEEASRLFIKHSR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatttaggtttactcatgaagagattactgttagtaggaacaattgcattaagt
atgttatgtacggaaagcatgatgaatgattatatggtgggagctaaggtgatacaagta
gaacgtcaaccgaaaaatgtaatcataatggttatggacggaacgagttctacagcaact
acattagctcgcttatataaagggaaagcacttgcattagatgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcgaattctggatatgtaggggtattacctactattgtgagttca
cctggcttaaaatcaataaaagaagaggacaagttacgtccagttgccaatgttttagaa
ggtgcgaaacgtactggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcccgctggattctctgctcaccatgtaaaccgcaagcattttgacgtaattgcggag
caacaagtgtatcaaaatatagatgtcgtattaggcgggggaaaagcggcactgctacct
ataaaaagaaaagatggtgaagatttagtaaaagtgattcaaaataaaggctacgacttt
attgaaacgaaagaggcattattgaaatctaaatctaataaaatgtggggctctttctca
cataatgccttagcgtttgatatggatcgtgaagcaacaaatccggagcaaccaacactt
tcgcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagatgggttcttttta
tttgtggaaggaagtaagccagattgggctgcacatgtgaatgatccaattgggatgatt
agtgatgtattggcatttgataatgcagttgcagaagcattaagatttgcaaaaaaagat
ggtaatacgatgctaatagccgtagcggaccatggtaacagcggtatttctattggcaat
atgaatacgacaaaaggttataatactacgccggtctctacatatattgatccattgaaa
aaagcgaaaatgacacttgaagggactatcaataatttgaaatctgatatatccaatgta
gaagaggtagctaaattatacgggttggacaatttaacttatgatgaaaaagaaaggtta
aaagtggttaaaaagaaaatagatgtaggtccaattttcactacattattggctaaccgt
gcgaacataggcttcacaacaggagggcatactggtgaggatgtatttttatattcatac
ggtcctcaaaagccagttggtttgattcaaaacacggacgttgcaaagacaatggcgaaa
gcgatgggctttaatttagaagaagtaacaaacaaattatttgtagagagtgaattagcc
tttaagcagaatggtgcgactgtaacagtagataatactaatgcagtaaatcctgtgctc
atagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaatataattcgtatt
aagaataaagattatgaattaggaagtgttgttgtagaaagcaatggtaaattctatgta
ccagaagaagcaagtcgtttattcataaagcattctcgttaa

DBGET integrated database retrieval system