KEGG   Bacillus cereus FRI-35: BCK_22085Help
Entry
BCK_22085         CDS       T02291                                 

Definition
(GenBank) acetoacetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00010  Glycolysis / Gluconeogenesis
bcer00620  Pyruvate metabolism
bcer00640  Propanoate metabolism
bcer00680  Methane metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCK_22085
   00620 Pyruvate metabolism
    BCK_22085
   00640 Propanoate metabolism
    BCK_22085
  Energy metabolism
   00680 Methane metabolism
    BCK_22085
Enzymes [BR:bcer01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCK_22085
Lipid biosynthesis proteins [BR:bcer01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCK_22085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFQ12299
Position
complement(4301276..4303216)
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLENGTPFAQWYNGGTCNVVESVLSRWLADDETRTQPALQYEGENGTSKSFTYEEL
DSWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDKYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFTEELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacgcgtttatatggt
tggatgaaatcattgggctatgaagattatgaaacgttttataataagtcaatcgaagaa
acagcttggttttggggagaagctgagaaagcagttggctatcaatggatgaaaccttat
acagaagtgctagatttagaaaatggtacgccatttgcacagtggtataatggcggaaca
tgtaatgttgtagaatcggttttatcacgctggcttgcagatgatgaaacgaggacacaa
ccagcacttcagtatgaaggggaaaatggaacttcaaaatcatttacatatgaggagctt
gatagctgggtaagtcgcgttgcaaacggtttgaaacatgcgggtattgaaaaaggtgat
cgtgtcacaatttatatgccgatgattccagaaaccgttgttgcgatgctagcggttatg
aagatcggagcaattatttcaccaatattctcaggatttgcatctgatgcagtcatgaca
cgtgtacaagcggcagggtctaaaatgattattactgcagatggtttttcacgccgaggt
aaaattgtttcattaaaagatgaagtagataaagcttgtgagcattgtccaactgttgaa
aaagttgttatcgtgcgtcatgcaggaaatgattttacaccgcataattatgatttctca
tggagtacattagaaaaagaaaaaccatttgtacatgctgaagaaatgcatagtgatgat
ccattaatgctcatttatacatcaggtactactggaaaaccgaaagggacagtacacact
catgctggatttcctttaaaagcagcttttgatgcgggatttggaatgaatatcaaacaa
ggtgaccgcgtattatgggtaactgatatgggatggatgatgggaccatttttattattt
ggctctctcattaatggagcaacgatggttatgtatgaaggtgttccggacttcccagaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatctcggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgataagtatgtaaataaacattcactcaag
agtttagaagtatttgcttcaacaggtgagccttggaatccagatccttggatgtggcta
tttgaaacagttggaaaaagtaatgtaccaatttgtaactattcaggcgggactgaaatt
tctggtgggattttcgggaacgtccttattaaaccaattgcaccgattagctttaacgct
tctttaccaggaatggcagcggttgtgctcgatgatcaaggcaatccgattcgtgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagac
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcatggtgac
tgggttgtttacgatggtgagcaatatattattacaggacgctcggatgatacgttaaac
attgctgggaaacgtattggacctgctgaatatgaatcaattcttgtaaagcataatgat
gtcatagaagctgccgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagataatgtaacatttactgaagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgacgcgtcattaaagccgcttatttagga
aaagaattaggcgatttatcatcacttgtaaatcctgaggtagttccgtttattcaggga
ttgcagtctagtaaattataa

DBGET integrated database retrieval system