KEGG   Bacillus cereus FRI-35: BCK_22830Help
Entry
BCK_22830         CDS       T02291                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00860  Porphyrin and chlorophyll metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCK_22830
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCK_22830
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BCK_22830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 NuA4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFQ12444
Position
complement(4456993..4458393)
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLIKDLNLEEEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVQSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEVLTETV
VKKGVVTTAVSKQGNRYEVSFANQESIQADYVVLAAPHDIAETLLQSNELNEQFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGNQKLLVRMFYKS
TNPVYETIKNYNEEELVRVALYDIEKSLGIKGEPEVVEVTKWKDLMPKYHLEHNQAVQTL
QEKMKDLYPNVYLAGASYYGVGIGACIGNGKNTANKIIATLNEPTN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgtcatcggtggaggtataacaggactttctactatgttttattta
gaaaaattaaaaaaggattataatatagatttaaatttaatccttgtagaaaaagaagag
tacttaggtgggaaaatccatagtgtagaagaaaaggattttattatggaatccggagca
gattctatcgttgctcgtaatgaacatgtcatgccgcttataaaggatttaaatttagaa
gaagaaatggtgtataacgaaactggtatttcttacatatattctgataatactttacat
ccaattccttcggatactatatttgggataccgatgagtgtccagtcgttgtttagcagt
acgctagtatcaacgaaagggaaaattgttgctttaaaagatttcataacgaaaaataaa
gagtttacgaaggatacttctcttgctgtatttttagaaagctttttagggaaagagtta
gtagaaagacaaattgctccggtgctttcaggtgtatattccggaaaattgaatgagctt
actatggcgtctacactaccgtatttactggattataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaaacagtttcaatcagcaggaaataaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaagtgctgactgagacggtt
gttaagaagggtgttgtaacgacagctgtaagtaaacaaggtaatcgctatgaagtctcc
tttgcaaatcaagaatcaatccaagctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgagcagtttcatacatttaaaaattca
tcacttataagtatttacttaggatttgatatactagatgaacaattaccagcggacggc
acaggatttatcgtaacagaaaacagtgatttacattgtgatgcttgtacatggacaagt
cggaagtggaaacatacatctggaaaccaaaagctattagtgagaatgttttataagagc
actaacccagtatatgaaacgattaaaaattataatgaagaagaactagtacgagtcgct
ttatatgatattgaaaaaagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aaatggaaagatttaatgccgaaatatcatttagaacataatcaagcagttcaaacatta
caagaaaaaatgaaggatctatatcctaatgtatacttagcgggtgcctcatattacggt
gtcggcattggtgcgtgtattggaaatggaaagaacactgcaaataagataattgcaaca
ttaaatgaaccgacaaattaa

DBGET integrated database retrieval system