KEGG   Bacillus cereus FRI-35: BCK_23575Help
Entry
BCK_23575         CDS       T02291                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00250  Alanine, aspartate and glutamate metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCK_23575
Enzymes [BR:bcer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCK_23575
Peptidases [BR:bcer01002]
 Cysteine Peptidases
  Family C44
   BCK_23575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase Arginosuc_synth DUF1933
Motif
Other DBs
NCBI-ProteinID: AFQ12591
Position
complement(4610047..4611948)
Genome map
AA seq 633 aa AA seqDB search
MCGFVGCLCENPREFSETEKHQFENMNTMIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEA
GHQPLTYENDRYVIIFNGEIYNYVELREMLLEKGATFATQSDTEVIIALYAHMKEKCVDY
LRGMFAFMIWDREEKKLFGARDHFGIKPLYIAQQGDTTFFASEKKSIMHVMEDKGVNPTS
LQHYFTYQYGPEPETLTIDVNKIEPGHYFVKEIGKEMEIHRYWKPYFNASSATKEEHIQA
IRDVLYDSVKVHMRSDVPVGSFLSGGIDSSIIASIAREMNPNLLTFSVGFEQRGFSEVDV
AKETAEKLGVKNHNVFISAKEFMDEFPKIIWHMDDPLADPAAVPLYFVAKEARKHVTVVL
SGEGADELFGGYNIYREPNSLKMFSYIPSPGKSVLKALSGALKEGFKGKSFLERGCTPIE
ERYYGNAKIFREEEKAELMKYYNESVNYMDITKPLYNEIKDYDDVSKMQYIDMFTWLRGD
ILLKADKMTMANSLELRVPFLDKEVFDVASKIPTEFKIANGTTKAILREAARGIVPDHVL
DRKKLGFPVPIRHWLKDEMHDWAINIINESKTEHLIDKQYVLNLLEAHCADKGDYSRKIW
TVLAFMVWHQIYVEHKYDTNKFHEETKRAYSLV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtaggatgtttatgtgaaaaccctagagagttttcagaaacagaaaaa
catcaatttgaaaatatgaacacgatgattttccaccgtggtccagatgacgaaggatat
tttcgtgatgagcatgtacaatttggcttccgccgtttaagtatcattgacttagaggca
ggacatcagccgctaacttatgaaaatgatcgatatgtaattatttttaatggtgaaatt
tacaactatgtagaattacgtgaaatgttacttgaaaaaggtgcaacgtttgcaacgcaa
tctgatacagaagttatcattgcattgtatgcacatatgaaagaaaaatgtgtagactac
cttcgtggtatgtttgcatttatgatttgggatcgtgaagaaaagaaacttttcggtgca
cgtgaccacttcggtattaaacctttatacatcgcacaacaaggtgatactacattcttc
gcatctgagaagaaaagtattatgcatgtgatggaagataaaggcgttaacccaacgtca
ttacaacattattttacgtaccaatatggtccagagccagaaacattaacaattgatgtt
aataaaatcgaacctggtcattatttcgtaaaagaaatcggtaaagagatggaaatccat
cgctactggaaaccttatttcaatgcttcaagtgcaacgaaagaggagcatatccaagca
attcgtgatgtgttatatgattcagtaaaagtgcatatgcgcagtgatgtaccagtaggt
tcattcttatctggtggtatcgattcatctatcatcgcttctatcgcaagagaaatgaat
ccaaatcttttaacattctctgttgggtttgagcaacgtggtttcagtgaagttgatgtt
gcgaaagaaactgctgagaaattaggcgttaaaaaccataacgtattcatttcagcgaaa
gagtttatggatgagttcccaaaaatcatttggcatatggatgatcctttagcagatcca
gcagctgtaccgttgtacttcgttgctaaagaagcacgtaagcatgtaacagttgttctt
tcaggcgaaggtgcagacgagctatttggtggttataacatttatcgtgagccaaactca
ctgaaaatgttctcttacattcctagcccaggtaagagcgttctaaaagcactaagtggt
gctcttaaagaaggctttaaaggaaagagcttcctagagcgtggatgtacgccaattgaa
gagcgttactatggaaacgcgaaaatcttccgtgaagaagagaaagctgaattaatgaag
tattacaatgaaagtgttaactatatggatatcacgaaaccattgtataacgaaattaaa
gattatgatgatgtaagcaaaatgcagtacattgacatgttcacatggttacgcggtgac
attttattaaaagctgataaaatgacaatggcaaactcattagaacttcgtgtaccgttc
ttagataaagaagtattcgatgttgcatctaaaattccaactgaatttaagattgctaac
ggaactacgaaagctattttacgtgaagcagcacgcggaatcgttccagatcacgtatta
gatcgtaaaaaacttggattcccagtaccaattcgtcactggttaaaagacgaaatgcat
gattgggctatcaatattataaacgagagtaagacagagcatttaatcgacaaacagtat
gtattaaacttactggaagcacattgtgcagataaaggcgattatagccgtaaaatttgg
actgtacttgcgtttatggtatggcatcaaatttatgttgagcataaatacgatacgaat
aagttccacgaagaaacgaaacgtgcgtatagcttagtttaa

DBGET integrated database retrieval system