KEGG   Bacillus cereus FRI-35: BCK_24225Help
Entry
BCK_24225         CDS       T02291                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00360  Phenylalanine metabolism
bcer00362  Benzoate degradation
bcer00620  Pyruvate metabolism
bcer00621  Dioxin degradation
bcer00622  Xylene degradation
bcer00650  Butanoate metabolism
bcer01100  Metabolic pathways
bcer01120  Microbial metabolism in diverse environments
bcer01220  Degradation of aromatic compounds
Module
bcer_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCK_24225
   00650 Butanoate metabolism
    BCK_24225
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BCK_24225
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCK_24225
   00622 Xylene degradation
    BCK_24225
   00621 Dioxin degradation
    BCK_24225
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCK_24225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored IlvN TrkA_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFQ12721
Position
complement(4739915..4740814)
Genome map
AA seq 299 aa AA seqDB search
MQKVKAAIIGSGNIGTDLMYKLRKSEVIDLSAMIGIDVESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHSYHAKTLEELEKIVIDLTPAAYGPFVCPAIRNNNFLDKKN
VNMITCGGQATIPIVHAINEVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEV
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPAYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIISEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagtaaaggcggccataattggatcaggtaatattggtacggatttaatgtat
aaattaagaaaaagtgaagtcatagacctcagtgccatgattggaatagatgtagaatcg
gatggtttaaagagggcgaaagaagccggatacgaggtttttgataatggaatacaggcg
attattgataatccgagtttagctgatattgtatttgatgcaacttcagctaaagcacat
agttatcatgcgaaaacgttagaagagcttgaaaaaatagtaattgacttaacaccggct
gcatatgggccatttgtttgtcctgctattcgaaataataattttttagataagaaaaac
gttaatatgattacgtgcgggggacaagcaacaatcccgattgttcatgctattaatgag
gtggcgaatgttacatatgcagaaatcgttgctacaatttccagtttaagtgcaggtcca
ggtacaagagcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaagtt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataaaatggtagaacgggttaggacgtatgttcctgcttactctttgaaacaagaa
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcatttcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system