KEGG   Bacillus cereus FRI-35: BCK_25465Help
Entry
BCK_25465         CDS       T02291                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCK_25465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCK_25465
   00052 Galactose metabolism
    BCK_25465
   00500 Starch and sucrose metabolism
    BCK_25465
   00520 Amino sugar and nucleotide sugar metabolism
    BCK_25465
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCK_25465
   00524 Butirosin and neomycin biosynthesis
    BCK_25465
Enzymes [BR:bcer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCK_25465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4984602..4985543)
Genome map
AA seq 313 aa AA seqDB search
MGKYVACFDIGGTFIKYAMIDEQGMVHEQGKITTPVQNQKKEILYRICEVIYEFEKSYKI
HSVGVSSCGIIDNIKGEVLYSANISGYSGTKIADYIYSETGYVASIENDVRSACLGEMWK
GVGQGKEHIVLITLGTGIGSGIIINGKMLQGVKGLAGELGHMIIVHNGEKCSCGGEGCYE
RYASTSALIRQYKEASKIQGLEIGTITGEEIIERMYRGERLAKDVYEQFLQYVVAGLVNI
TYIFNPELIIIGGGITEQGEPFLKQIQERFHDKIMDIYQNKVEIALASLHNDAGVYGACY
VALNQCEEKSMKI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtacgttgcttgttttgatattggaggaacttttataaaatatgcaatgatt
gatgaacaaggaatggtacatgaacaagggaaaataacaacaccagtacaaaatcaaaag
aaagaaattttgtatcgcatttgtgaagtaatatatgagtttgaaaagagctataaaatt
cattctgtaggtgtatcatcgtgtgggattattgataatatcaagggggaagttctgtat
tctgccaatatttcgggatatagcggtacaaaaatagcagattacatttatagtgagaca
gggtatgtggcgagtattgaaaatgatgttcgttcagcttgtctcggtgaaatgtggaaa
ggagtagggcaggggaaagaacatattgttttaatcacacttggaaccggaattggtagt
ggaatcattataaatggcaaaatgcttcagggagtgaaaggattagcaggagagcttggt
catatgataattgttcataatggagaaaaatgtagttgtggcggagagggatgttatgag
agatatgcatcgacttcggcattgattcgtcagtataaagaagcatcaaaaattcaaggg
ctagagataggtacaatcacaggtgaagaaattatagaacgtatgtacagaggagaacga
ttggcaaaggatgtatatgaacagtttctacagtatgttgttgctggtttagtaaatatt
acttatatatttaaccccgaattaattattattgggggaggtattacagagcaaggtgaa
ccatttttgaaacaaattcaagaaaggttccatgacaaaataatggatatctatcaaaat
aaggtggaaatcgctttagcatcattacataatgatgctggtgtatatggagcttgttat
gtagcgttgaatcaatgtgaggaaaagtcaatgaagatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system