KEGG   Brucella ceti TE10759-12: V910_101417Help
Entry
V910_101417       CDS       T02934                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bcet  Brucella ceti TE10759-12
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcet00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    V910_101417
   00051 Fructose and mannose metabolism
    V910_101417
Enzymes [BR:bcet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     V910_101417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1443267..1444574
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSFAWEGGDP
FGGRTFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGRNFAENTRYLNE
IVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPDVFAFAAATVKTCIDATKRLG
GENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALARTLGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGGTNFDAKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAARMLEDGALSKPLDERYAGWNGEFGKRLLSGLSLDQIAGEVEAKDINPQPK
SGRQEYLENIVNRYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggatttttcggcgatattcagaaggtgcgctatgaggggccggagagcgac
aatccgctggccttccgccattataatgcagatgaaatcgtgctcggcaaacgcatggaa
gaccatttgcgctttgcggtggcctattggcacagtttcgcctgggagggtggcgatccg
ttcggcgggcgcaccttcgaccggccgtggttttccaacgagatcgatgcggcaaaactc
aaggccgatgtcgcctttgaattcttctccctgctcggcgcaccttattactgcttccac
gatgccgatgtgcggccagagggccgcaattttgcggaaaacacgcgctatctcaatgaa
attgtcgatattttcgagaagaagcaggccgaaaccggcatgaaactgctctggggcacg
gccaatcttttttccaaccggcgctatatggcgggtgcggccacaaatcccgatcctgat
gtcttcgcttttgccgctgcaacagtgaagacctgtatcgacgccaccaagcggctcggt
ggagagaattacgtgctttggggcggtcgcgaaggctatgaaaccctgctcaataccgat
ctttcgcgtgaactcgaccatatgggccggttccttagcctcgtggtggaatacaagcac
aaaatcggcttcaagggcacgatcctgatcgagcccaagccgcaggagccgaccaaacat
cagtatgattacgatgtcgcgacggtttacggcttcctcaagcgttacggtctggaaaac
gaggtgaaggtcaatatcgagcagggccatgccattctggccggtcactcgttcgagcat
gagctggcgcttgcccgcacacttggcattttcggctccatcgacatgaaccgcaacgat
taccaatccggctgggacaccgatcagttcccgaacaatgtgccggagatggcgctggcc
tattatcaggttctgctggcaggcggcttcacgaccggcggcacgaatttcgacgccaag
ctgcgccgccagtcgcttgatccgcaggatctgctaatcggccatattggcggcatggat
tgctgtgcacgcggactaaaagcagccgcgcggatgcttgaagacggcgctttatccaag
ccgcttgatgagcgttatgcgggctggaacggcgagttcggcaagaggcttctgagcggc
ctttcgctggaccagatcgcgggtgaagtcgaagcgaaagacatcaatccgcagccgaaa
tccggccgtcaggaatatctggaaaacatcgtcaatcgctacgtttga

DBGET integrated database retrieval system