KEGG   Brucella ceti TE10759-12: V910_200087Help
Entry
V910_200087       CDS       T02934                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcet  Brucella ceti TE10759-12
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcet00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    V910_200087
Enzymes [BR:bcet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     V910_200087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(88820..89761)
Genome map
AA seq 313 aa AA seqDB search
MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGA
IRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGAN
ARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMA
DLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTAD
EVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAA
PTAREVEELIGRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggagaagccccgttgaagattttcgttttcggcagtgtgaatgtggatgta
agcgcccgaatggctgccctgccacggccggggcagacggtaaacgcatccggctatggc
atcgggctgggtggcaaaggagccaatcaggcggttgcggtggcaaaacttggcggggca
atccgatttgtcggcgcggtcggccatgatgcctttggcgaactggccttaaagcagatg
cgcgagtttgggctggataccggcagcgtgcgcgtgatcgatgacgtcgatacaggcatg
gcgatcatccaggtggaggaaaccgggcagaacacgattgcggtctgtgctggcgccaat
gcgcgctggtcgtcagccgatattgatgcttatggcgctgatattgccaaggcaaggatt
acgcttttgcagcgcgaagtgccgcatgaagccaatctggccgttgcgaaagccgtgcgg
gcagcgggtggaaccgtcctgctcgacccggccccggtgggggatgcaagccagatggcc
gatcttatcgccctgagcgacatcatttcgcccaacgagacggaagccgctgaaatcacc
ggcattgagccgaccgacctcgcttcggcggaagcggcggggcgcaagcttctggagcgc
ggcccgaagatcgtcatcctcaagcttggaagccgtggcgcgctgctggtaacggcggat
gaggtgaaacacttcacgccgttcaaggtaaaggtggtggatacggttgcagccggtgac
agtttcaacggcggctttgccgttgctttctcgcaggcgcggcccttgcatgattgcgtg
cggtatggttcggcggcgggcgcgattgcggttacgcgggttggcgcaggcgctgccgcg
ccaaccgcgcgtgaggttgaggaactcatcgggcgcgcttga

DBGET integrated database retrieval system