KEGG   Brucella ceti TE10759-12: V910_200881Help
Entry
V910_200881       CDS       T02934                                 

Gene name
gadB
Definition
glutamate decarboxylase beta (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bcet  Brucella ceti TE10759-12
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bcet00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    V910_200881 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    V910_200881 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    V910_200881 (gadB)
   00430 Taurine and hypotaurine metabolism
    V910_200881 (gadB)
Enzymes [BR:bcet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     V910_200881 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(933595..934989)
Genome map
AA seq 464 aa AA seqDB search
MTGSNYPARDLIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLAT
FCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNT
IGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPME
PGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVD
AASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNV
DYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPY
EFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRV
MCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaactatccggcgcgggatttgattgcctctgtttttggcaccgaggct
ttacaggaaattgctgcttcgcgtggttttcgcgaaaaggaaatgcaggcgaacgctgtt
taccagattattcatgacgaactgtttctcgatggtaatgcccgtcagaatctggcgacc
ttctgtcagacatgggatgatgattacgtccacaagctgatggacctttcgatcaacaag
aactggatcgacaaggaggaatatccccagtcggcggccattgatctgcgctgtgtcaac
atggtcgcggacctctggaatgcacccaaattcgccgataatgccacaggcaccaatacg
atcgggtccagcgaggcctgtatgcttggtggtatggccatgaaatggcgctggcgcaag
aagatgcaggaaatgggcaagccgacggacaagcccaatttcgtttgtggcccggtgcag
gtgtgttggcacaaattcgcccggtactgggatgtcgagatccgggaaattccgatggag
cctggccgcctgttcatgggaccagaacaaatgcttgaagccgttgatgaaaataccatc
ggcgtcgtgcccactttcggcgtgacctataccggcaattatgaatttcccgaaccgttg
caggatgcgctggacaagctgcaaaagaccaagggtcttgatatcgatatccatgtcgat
gcggcaagcggcggctttctggcaccattttgcgcgcccgatattccgtgggatttccgc
ctgccgcgcgtgaagtcgatcagcgcgtcaggccataaatacggtctcgcaccgcttggc
tgtggctgggttgtctggcgcgacaaagaggccctgccggaagagctgatcttcaatgtg
gattatctcggtggacaggttggcactttcgcaatcaatttctcgcggcctgccggtcag
gtcatttcacaatattacgaattcatgcgtcttggccgcgaaggctacaccaaggtgcag
caggcggcctaccgcgtggcgcaatatatagccagggagatcgagccgcttgggccttat
gaattcatctgcgcgggcgaggagaaaggcggcattcccgccgtctgtttccgcatccgt
gaaggcgaagaccccggttattcgctctatgatctgtcggaacggctgcgtctgaccgga
tggcaggttcccgctttcgctctttcgggcaaggcgtcggatatcactgtcatgcgcgtc
atgtgccgccgcggtttcgagatggatctggctgcactcttcattcgggatttcaaggct
gggatcgagttcttcaaatcgcatccttcaccgaagattaccccgtcgatgggaaccggc
tttcaccacacataa

DBGET integrated database retrieval system