KEGG   Bacillus cereus F837/76: bcf_00410Help
Entry
bcf_00410         CDS       T01703                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcf  Bacillus cereus F837/76
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77517..78350
Genome map
AA seq 277 aa AA seqDB search
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHII
DIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDEN
IILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGA
TVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaatgaaaaaacg
ttaattatggggattttaaatgtaacaccagattcgttttctgatggtgggagttataat
gaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgctcatattatt
gatattggtggcgaatctactcgtccgggttttgctaaagtatcggtggaagaagaaata
aaacgagttgttccgatgattcaggctgtttcaaaagaggtaaaattgcctatttctatc
gacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcatattattaat
gatatttggggagcgaaggcagaaccaaaaatcgctgaagttgcagctcattacgatgta
cctattatcttaatgcacaatcgcgataacatgaattatcgtaatttaatggctgatatg
attgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcgagatgagaat
atcattttagacccgggtatcggttttgctaaaacacctgaacaaaatttagaagcgatg
cgtaatttagaacagttaaacgtactaggttatccagttctcttaggtacttcaagaaag
tcctttattgggcatgtgctagatttaccggtagaagaacgccttgagggaacgggagct
accgtttgtcttggtattgaaaagggttgtgagtttgttcgcgttcatgatgtgaaggaa
atgtcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaagtaa

DBGET integrated database retrieval system