KEGG   Bacillus cereus F837/76: bcf_00560Help
Entry
bcf_00560         CDS       T01703                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bcf  Bacillus cereus F837/76
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bcf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103048..104505
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagagctagaggcagaacgcgaa
gggcaaattgctcgtggtgaaacacctcgttacgcaggtaaccaccgtgatttaactgaa
gcgcaagtgaaagaatttgaagctgagggacgtattccaagtattcgtttccgcgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccattcaaat
gatttcggtgatttcgttatcgtgaaaaaagatgggattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtacttcgtggtgatgaccatatttca
aacacgccaaaacaaatgatgatttatgaagctttcggttgggatattccgcaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcactactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgtttgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtggtagaatta
agcttaccgcatttagtgaaggctggacgtataggtgagactttaagtgaacaagaacaa
gcttggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcacgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcaattaaggcggctattaaagcggttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactactggtcaaacacat
ggcccagagcttcctaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system