KEGG   Bacillus cereus F837/76: bcf_03415Help
Entry
bcf_03415         CDS       T01703                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcf  Bacillus cereus F837/76
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bcf_03415
Enzymes [BR:bcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     bcf_03415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664621..665517
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVKKNLENERVFIDYVVPVTDATTGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagcatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggtaggagcg
gtaggagacgataattatggaactgtagtgaagaaaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcgacgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggggcgaatgctcttgtaaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattggctatttgtgaggaacacaaaatcccggttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acaccaaatgaacatgaatgccgcatcgtattagatgatttcacatcgccaattgaagat
ttactggctaaatatccgaataaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggcgaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggggcg
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcgggtga

DBGET integrated database retrieval system