KEGG   Bacillus cereus F837/76: bcf_05185Help
Entry
bcf_05185         CDS       T01703                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcf  Bacillus cereus F837/76
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    bcf_05185
Enzymes [BR:bcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     bcf_05185
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bcf_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
996571..998061
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYG
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcgcaagaaatttggggatctattttagcggttatcgca
acttgtttaagtgaagctgatgtaaagccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacgactggtaaaccaatttataacgcaatt
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatggc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgatacgtggcttgtatggaaactatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacattaatgtttaacattcacgacttacagtgggatgat
gagcttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgcaggt
gtagctggtgatcaacaagcggcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacacaggtgaaaaagcagtcgct
tctgagcatggcctattaacaacaattgcatggggaatagatggtaaagtaaactatgca
ttagaaggaagtattttcgtagcaggttctgcaattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtgtatgcttctcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggattaggtacaccttactgggatagtgaagtacgc
ggcgctatgtttggtgtaacacgcggtacgacgaaagaacacttcattcgtgcaacacta
gaatctttagcttaccaaacaaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactaaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagacgttcctgtagagcgtccagtgatcaatgaaacaacagcttta
ggtgcagcgtatttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgttttgaaccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system