KEGG   Bacillus cereus F837/76: bcf_06110Help
Entry
bcf_06110         CDS       T01703                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bcf  Bacillus cereus F837/76
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    bcf_06110
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bcf_06110
Enzymes [BR:bcf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     bcf_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164953..1165498
Genome map
AA seq 181 aa AA seqDB search
MKVIETNFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSADHDSGILWNDKELAIPWPVTSPILSDKDRILPLLQECEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagaaacaaactttaccgacgcaaaattgttggaaccgaggttatttgga
gatgatcgtggcttttttactgaaagttataataagaaggtgctagaaacattaggggtt
acgcattcatttgtacaggataatgtctcgtattcagcggaagcgggaacgattcgcgga
ttacattttcaaaaaaatccgaaagcacaaacgaaacttattcaagttatgcaaggagca
atctatgacgttatcgtagatttgcgaaaagattcaccaacgtttaaacagtggagaggg
tatattttaagcgcggataatcatcggcaattattagtgccaaaaggatttgcacatggt
ttttgtacacttgtcccgcatacgattgttatgtataaagtagatgagtattatagtgcc
gatcatgactcagggatactttggaacgataaagaattagcaattccatggccggtaaca
agtcctattttgtctgataaagatcgaatattaccattacttcaggaatgtgaagatagc
ttttga

DBGET integrated database retrieval system