KEGG   Bacillus cereus F837/76: bcf_07120Help
Entry
bcf_07120         CDS       T01703                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bcf  Bacillus cereus F837/76
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bcf_07120
  Amino acid metabolism
   00340 Histidine metabolism
    bcf_07120
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     bcf_07120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337160..1338449
Genome map
AA seq 429 aa AA seqDB search
MEIVCEDFQKALTKIKLLRENANIIEETVQRSVREIVHNVRESRDEALSFYTKKFDGVEI
KDVRVSEEEIKQASMFVESSFLEALQEAKKNIISYHEKQKRQSMFDCTSKGIIRGQIIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRAGGIDPHILVAASLAGVDE
IYMIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIN
RNGAIFIVPSIDEALQLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVKHHIVELANKEGLHAHARA
IQIRFGEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtttgtgaggattttcaaaaggcgttaacgaaaataaaactgttacgagaa
aacgctaatataatagaagaaactgttcaaagaagtgtcagggaaatcgttcataacgta
agagagagtagagatgaggcgttatctttctatacaaaaaagtttgatggtgtagagatt
aaagatgttcgtgtaagtgaagaagaaataaaacaagcgagtatgtttgtagagagttca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatcgatgtttgattgcacgagtaaaggcatcataaggggacaaatcattcggccg
ttagaaaatataggggtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaagctcgcgggtgtgaaaaagattgtaatggtaacaccgcca
agagcaggaggaattgatccgcatattttagttgctgcaagccttgcaggagtagatgaa
atttatatgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccaaaagtagataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatatggaatagtaaatatcgatatgattgctggaccgtcagaaatagtagttattgct
gatgaaactggcaatgcaaaatatattgctgctgatttattatcacaagcagaacatgat
gagagagcgacagcaatttgtattacaacgaatatagaattagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaat
agaaatggagccatttttatcgttccttctatagatgaggcactacagttatcgaatgaa
atcgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccgtatgcaccagaaccgctcggtgattattta
gcgggaccgaatcacgtattaccgacaagtggaacggcaaggtttttctccccgttatca
gtcgatgatttcgtgaaaaaatcaagttttctatcttatacggaggaagcattaagagat
gtaaaacatcatattgtagaacttgccaataaagaagggctacatgcgcatgcgagagca
attcaaataagatttggggaggaagaataa

DBGET integrated database retrieval system