KEGG   Bacillus cereus F837/76: bcf_10210Help
Entry
bcf_10210         CDS       T01703                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bcf  Bacillus cereus F837/76
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    bcf_10210
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bcf_10210
   00650 Butanoate metabolism
    bcf_10210
  Amino acid metabolism
   00360 Phenylalanine metabolism
    bcf_10210
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bcf_10210
   00622 Xylene degradation
    bcf_10210
   00621 Dioxin degradation
    bcf_10210
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     bcf_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1926552..1927451
Genome map
AA seq 299 aa AA seqDB search
MQKVKAAIIGSGNIGTDLMYKLRKSEVIDLNAMIGIDVESDGLKRAKEAGYEVFDNGIQA
IIDNPSLADIVFDATSAKAHRYHAKTLEELEKIVIDLTPAAYGPFVCPAIRNNNFLDKQN
VNMITCGGQATIPIVHAINGVANVTYAEIVATISSLSAGPGTRANIDEFTITTKRGIEEV
GGADKGKAIIILNPAEPPILMRDTIYCEVKDMDEVSIYEAIHKMVERVRTYVPGYSLKQE
PMFDGNRVTVFLEVEGAGDYFPPYAGNLDIMTAAALKVGEEFATQIISEKKRGVMNEAK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagtaaaggcggccataattggatcaggtaatattggtacggatttaatgtat
aaattaagaaaaagtgaagtcatagacctcaatgccatgattggaatagatgtagaatcg
gatggtttaaagagggcgaaagaagccggatacgaggtttttgataatggaatacaggca
attattgataatcccagtttagctgatattgtatttgatgcaacttcagctaaagcacat
agatatcatgcgaaaacgttagaagagcttgaaaaaatagtaattgacttaacaccggct
gcatatgggccatttgtttgtcctgctattcgaaataataattttttagataagcaaaac
gttaatatgattacgtgcgggggacaagcaacaatcccgattgttcatgctattaatggg
gtggcgaatgttacatatgcagagatcgttgctacaatttccagtttaagtgcaggtcca
ggtacaagggcaaatattgatgaatttacaattacgacaaagcgtggaattgaagaagtt
ggtggggctgataaggggaaggcgataattatattaaaccctgcagagccacctatatta
atgagagatacgatttattgtgaagttaaggatatggatgaggtttctatctatgaagca
attcataagatggtagaacgggttaggacgtatgttcctggttactctttgaaacaagag
ccaatgtttgatgggaatcgtgtaactgtatttttagaagttgaaggagctggagattat
tttcctccttatgccggtaatttagatattatgacagctgcagcattaaaagtaggtgaa
gaatttgcaacgcaaatcatctcagagaagaaaagaggtgtaatgaatgaggcgaaatag

DBGET integrated database retrieval system