KEGG   Bacillus cereus F837/76: bcf_10475Help
Entry
bcf_10475         CDS       T01703                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    bcf_10475
  Metabolism of other amino acids
   00480 Glutathione metabolism
    bcf_10475
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     bcf_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962560..1963042
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaataacaggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagcttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaaattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtagggcgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaggtacttggtgaa
taa

DBGET integrated database retrieval system