KEGG   Bacillus cereus F837/76: bcf_10475Help
Entry
bcf_10475         CDS       T01703                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bcf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bcf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962560..1963042
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaataacaggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagcttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaaattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtagggcgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaggtacttggtgaa
taa

DBGET integrated database retrieval system