KEGG   Bacillus cereus F837/76: bcf_12035Help
Entry
bcf_12035         CDS       T01703                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcf  Bacillus cereus F837/76
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    bcf_12035
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     bcf_12035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2278727..2280127
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLQEEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVESLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLAVFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDRYAISFANHDSIHADYVVLAAPHDIAETLLQSNELNEEFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRIFYKS
TNPVYETIKSYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtattacaggactttctactatgttttattta
gagaaattaaaaaaggattataatattgatttgaatttaattcttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttacaa
gaagaaatggtatataatgagacgggtatttcttacatatattctgataatactttacat
ccaattccttctgacactatatttgggataccgatgagtgtcgaatcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatcacttgctgtatttttagaaagcttcttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggcgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggctttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagtaaacaaggtgatcgctatgcaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaagagtttcatacatttaaaaactca
tctcttataagtatttacttaggatttgacatactagatgaacaattaccggcggacggc
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaattttttataagagt
actaatccagtatatgaaacgattaaaagttatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaaacatta
caagaaaaaatgatgaatctttacccgaatatatacttggctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaagaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system