KEGG   Bacillus cereus F837/76: bcf_12465Help
Entry
bcf_12465         CDS       T01703                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00010  Glycolysis / Gluconeogenesis
bcf00260  Glycine, serine and threonine metabolism
bcf00680  Methane metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
bcf01230  Biosynthesis of amino acids
Module
bcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcf_M00002  Glycolysis, core module involving three-carbon compounds
bcf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_12465
  Energy metabolism
   00680 Methane metabolism
    bcf_12465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bcf_12465
Enzymes [BR:bcf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     bcf_12465
Membrane trafficking [BR:bcf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    bcf_12465
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   bcf_12465
  Exosomal proteins of melanoma cells
   bcf_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEW55615
Position
2352900..2353637
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKELKKGEFPLTECLVDTEKRVLNYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDDLRPIRHYYLSMDGEVPEGEFP
KHIVF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgaaatgaatctttcctgggtaccagtacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggttaaataaagatgaa
acagcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctagatatgaaatgaatgatccaagatataaagaa
ctgaaaaaaggtgagtttccattgactgaatgtttagtggatacggagaaaagagtactt
aattattggcattcagaaattgcgccatcattaaaaagtggtgaaaaggtgataatttca
tcgcacggtaatacaattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacaagcattccgctcgtttatgaattagacgatgattta
cgtccaattcgtcattattatttaagcatggacggagaagtaccagaaggggaatttccg
aaacacattgttttttaa

DBGET integrated database retrieval system