KEGG   Bacillus cereus F837/76: bcf_12465Help
Entry
bcf_12465         CDS       T01703                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcf  Bacillus cereus F837/76
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bcf_12465
   01230 Biosynthesis of amino acids
    bcf_12465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_12465
  Energy metabolism
   00680 Methane metabolism
    bcf_12465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bcf_12465
Enzymes [BR:bcf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     bcf_12465
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   bcf_12465
  Exosomal proteins of melanoma cells
   bcf_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2352900..2353637
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKELKKGEFPLTECLVDTEKRVLNYWHSEIAPSLKSGEKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDDDLRPIRHYYLSMDGEVPEGEFP
KHIVF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgaaatgaatctttcctgggtaccagtacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggttaaataaagatgaa
acagcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcctagatatgaaatgaatgatccaagatataaagaa
ctgaaaaaaggtgagtttccattgactgaatgtttagtggatacggagaaaagagtactt
aattattggcattcagaaattgcgccatcattaaaaagtggtgaaaaggtgataatttca
tcgcacggtaatacaattcgttcgctagtgaaatacttagataacctttcaagtgatggt
gttgtttcattaaatattccaacaagcattccgctcgtttatgaattagacgatgattta
cgtccaattcgtcattattatttaagcatggacggagaagtaccagaaggggaatttccg
aaacacattgttttttaa

DBGET integrated database retrieval system