KEGG   Bacillus cereus F837/76: bcf_15745Help
Entry
bcf_15745         CDS       T01703                                 

Definition
pyridoxal phosphate-dependent deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bcf  Bacillus cereus F837/76
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bcf00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2973137..2974132)
Genome map
AA seq 331 aa AA seqDB search
MNLAKFPRKKYTESYTPIEKLNNFSEALGGPTIYFKRDDLLGLTAGGNKTRKLEFLVADA
QAKGADTLITAGGIQSNHCRLTLAAAVKEKMKCILVLEEGLEPEEKRDFNGNYFLYHLLG
AENVIVVPNGADLMEEMHKVAKEVSEKGNTPYVIPVGGSNPTGAMGYVACAQEIMAQSFD
QGIDFSSVVCVSGSGGMHAGLITGFAGTQSNIPVIGINVSRGKAEQEEKVAKLVDETSAH
VGIPNFIPREAVTCFDEYVGPGYALPTPEMVEAVQLLAKTEGILLDPVYTGKAVAGLIDL
IRKGTFNKEDNILFVHSGGSPALYANTSLFA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctaaattcccgagaaaaaaatatacagagtcatatacaccaattgaaaaa
ttaaacaatttttctgaggcacttggtgggccgactatttattttaaacgagatgattta
cttggtttaacagcaggcggtaataagacgagaaagttagagtttctagttgcggatgca
caggcaaaaggtgcggatacgttaattacagctggtggcattcagtccaatcattgccgt
ctaacactggcagcggcggtaaaagaaaaaatgaaatgtattcttgtattagaagaaggg
cttgagccagaagagaagcgagactttaacggaaactatttcttatatcatttactaggt
gctgaaaatgtaattgttgtaccaaacggagcagatcttatggaagagatgcataaagta
gcaaaagaagttagtgaaaaaggtaatacaccatatgtaataccagttggtggatcgaat
cctactggtgcaatgggatacgttgcttgtgcgcaagaaattatggcgcaatcatttgac
caaggaattgatttcagttcagtcgtttgcgtaagtggtagcggcggtatgcacgctggt
ttaattacaggttttgctggaacacaaagtaacatccccgtaatcggaattaacgtaagt
agaggaaaagcagagcaagaagagaaagtagcaaaacttgtagatgaaacgtcagctcat
gttggtattccaaactttatcccgcgcgaagcggttacatgctttgatgaatatgtagga
ccaggttacgcgttaccaacgccagaaatggtggaagcagtgcagctgttagcaaaaaca
gaaggtattttacttgatccagtatatacaggtaaagcagtagcgggattaatcgactta
attagaaaaggtacatttaataaagaggacaacattttattcgtacattcaggtggttca
ccagctttatatgcgaatacatctttattcgcgtaa

DBGET integrated database retrieval system