KEGG   Bacillus cereus F837/76: bcf_18580Help
Entry
bcf_18580         CDS       T01703                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcf  Bacillus cereus F837/76
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bcf_18580
   01230 Biosynthesis of amino acids
    bcf_18580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_18580
  Energy metabolism
   00680 Methane metabolism
    bcf_18580
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bcf_18580
Enzymes [BR:bcf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     bcf_18580
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   bcf_18580
  Exosomal proteins of melanoma cells
   bcf_18580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3513082..3513657)
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEKEILIYENLKECMFSSGDQVISDKEVYPLVKKMFSNPDFALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFELLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaaaagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccacttgtaaagaag
atgttctctaatcctgactttgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaacttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system