KEGG   Bacillus cereus F837/76: bcf_18975Help
Entry
bcf_18975         CDS       T01703                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00900  Terpenoid backbone biosynthesis
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01130  Biosynthesis of antibiotics
Module
bcf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bcf_18975
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     bcf_18975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEW56916
Position
complement(3602229..3603371)
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKVVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEIGTLHFEKMNQE
RFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARP
SLEEILEIDAATRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttattaggtgcaagcggatcaattggtacacaaactttagatgta
ttacgctcgcacccagaccaattccgtctcgttgctttttctgtagggaaaaatattgac
tacgcagtaaaggtcattcaagaattttctccacaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtttctggtaatacaaaagttgtatatggtagtgaaggg
cttttagaagtagcattacatccagatgcggagattgtagtaaacgctgttgtaggtagc
gtagggttgttaccaacacttcgtgcaattgaggcgaaaaaaacaattggaattgcaaac
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcgcgaaaacataatgtt
tcgttacttccagtagacagtgaacattcagctatttttcaatgcttgaatggtgaaaat
gaaaaaagaatttctcgactaattataacggcttctggtggaagtttccgtgataaaacg
agagatgaattgcatcatgtgaccgtagaagatgcgcttcgacatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacattggctttttggtatcccttatgagcaaatcgatgttgttttacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtgatggcacagcttggctcacct
gatatgcgagtaccaattcaatacgcgcttacatatcctgatcgattacctctttcagac
acaaagcagttaaacttatgggaaataggaacgttgcattttgagaagatgaaccaagag
cgtttccgttgcctacgttttgcgtatgaagctggaaaagcaggtggaagtatgccagct
gtaatgaatgcagcgaatgaagtagctgtggaagcttttttacaaaagagaattggtttc
ttaacagtggaagacctcattgaaaaagcaatgaaccatcacaatgtcattgcacgtccg
agcttagaggaaattctggaaattgatgcagccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system