KEGG   Bacillus cereus F837/76: bcf_19050Help
Entry
bcf_19050         CDS       T01703                                 

Definition
Succinyl-CoA ligase (ADP-forming) beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcf  Bacillus cereus F837/76
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bcf_19050
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bcf_19050
   00640 Propanoate metabolism
    bcf_19050
   00660 C5-Branched dibasic acid metabolism
    bcf_19050
Enzymes [BR:bcf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     bcf_19050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3617739..3618899)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gatgtatgtgtagtaaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
ccagaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgttctatcgcagagattaatcca
cttgttacaacaggtgacggtaaagttatggcattagatgcgaaattaaactttgattct
aacgctttatatcgccataaagacattttagaacttcgtgatcttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacgatggatatcattaaacattaccat
ggcgatccagctaacttcttagatgttggtggcggtgcgacagctgaaaaagttacagaa
gcatttaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgttgagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system