KEGG   Bacillus cereus F837/76: bcf_19725Help
Entry
bcf_19725         CDS       T01703                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00010  Glycolysis / Gluconeogenesis
bcf00020  Citrate cycle (TCA cycle)
bcf00620  Pyruvate metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
Module
bcf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_19725
   00020 Citrate cycle (TCA cycle)
    bcf_19725
   00620 Pyruvate metabolism
    bcf_19725
Enzymes [BR:bcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     bcf_19725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AEW57066
Position
complement(3750342..3751628)
Genome map
AA seq 428 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNE
RVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPA
AKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRK
KFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDK
GLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPV
INHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLND
PQLLVMEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagaagca
aaagaagaagctcctaaagctgaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatatgctcgtgaaaacggcgtagacattcat
aaagtagctggttctggtaagaacggtcgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaagcagtagcagcaactgaggctccagcagcagtagaagctactccagca
gcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaactcgt
gagaaaatgagtggtatccgtaaagcaattgcgaaagcaatggttaactctaaacataca
gctcctcacgtaacattaatggatgaagtagatgtaactgaacttgttgctcaccgtaag
aagttcaaagctgtggcagctgacaaaggtattaaattaacttaccttccatacgttgtt
aaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagatgatgct
tctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagacaaa
ggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcacaatttctaac
gagatcaatgatcttgctggtaaagcacgtgaaggtcgtttagctcctgctgaaatgaaa
ggcgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactccagtt
atcaaccacccagaagtagcaatccttggtatcggccgtatcgctgagaaaccagttgtg
aaaaacggtgagatcgttgcagctccagtattagcattatctctaagctttgaccatcgt
ttaattgacggcgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaatgac
ccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system