KEGG   Bacillus cereus F837/76: bcf_20090Help
Entry
bcf_20090         CDS       T01703                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bcf  Bacillus cereus F837/76
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bcf00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3817113..3817625
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPPHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgcattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctcct
catttaaatgaaaattattcgttaacagatgaaaacaaggctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcgcgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaactattaattaatttccaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system