KEGG   Bacillus cereus F837/76: bcf_21340Help
Entry
bcf_21340         CDS       T01703                                 

Definition
RNA polymerase sigma factor RpoD
Orthology
K03086  
RNA polymerase primary sigma factor
Organism
bcf  Bacillus cereus F837/76
Brite
Transcription machinery [BR:bcf03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     bcf_21340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4030377..4031498)
Genome map
AA seq 373 aa AA seqDB search
MADKPARSKQIETEMTLEQVKEQLTELGKKRGVLTYEEIAERMNGFEIESDQMDEYYEYL
GEQGIDLVGDNDEGPNNHQITKTEEEFDLNDLSVPPGVKINDPVRMYLKEIGRVDLLSAE
EEIRLATRIEEGDEEAKRRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKF
DYRKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPS
PEEIGEEMDLAPEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPADHAAYEL
LKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLR
HPSRSKRLKDFLE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaaccagctcgttctaaacaaattgaaactgaaatgacccttgagcaagtg
aaagaacaactcactgagctcggaaaaaaacgtggcgttcttacatatgaagagattgca
gaacgcatgaatggatttgaaattgaatccgatcaaatggatgaatactatgaatattta
ggtgaacaagggattgacttagttggcgacaacgatgaaggccctaataatcaccaaatt
acgaaaacagaagaagagtttgacctaaatgacttaagtgtaccaccaggggttaaaatc
aacgatcctgttcgtatgtatttaaaagaaattggtcgtgtagatttactatctgcagaa
gaagaaattcgacttgcaacgcgtattgaagaaggcgatgaagaagcaaaacgtcgtctt
gcagaagcaaacttacgtcttgtagtaagtattgcaaagcgctacgtaggccgcggtatg
cttttcttagacttaatccaagaagggaatatgggtctaattaaagcggttgaaaagttc
gattatcgtaaaggtttcaaatttagtacgtatgcaacttggtggattcgccaagcaatt
acacgtgcgattgcagaccaagcaagaacaattcgtatcccagttcatatggttgaaacg
attaataagttaattcgtgtacaacgtcaattattacaagatttaggacgtgaaccatct
cctgaagagattggtgaagaaatggatcttgctccagaaaaagtgcgcgaaatcttaaaa
attgctcaggagccagtctctcttgaaacaccgattggtgaagaagatgactcccattta
ggtgattttattgaagaccaagaagcaacatcgcctgcggaccatgcagcgtatgaattg
ctaaaagaacaattagaagatgtgttagatacactaacagatcgtgaagaaaatgttcta
cgtcttcgttttggtttagatgatggacgaactcgtacgcttgaagaagttgggaaagta
ttcggcgtaacgagagaacgtattcgtcaaattgaagcaaaagcacttcgtaaattgaga
catcctagccgtagtaagcgtcttaaggatttcttagaatag

DBGET integrated database retrieval system