KEGG   Bacillus cereus F837/76: bcf_21855Help
Entry
bcf_21855         CDS       T01703                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcf  Bacillus cereus F837/76
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4120167..4122503)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLIRETMSLLNNQEGRVTEEDIISCIEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPLQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVIKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggacattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaaacgcacagctgaaaaaattgtg
gaccatctaggggaacatgctatttctaaaattatggatgatcctgaggctttaaacggt
gttgttaacaaacaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
tatcagcagtataaagagatgacattagaagtgattcgtaataacccatatcagcttatt
gaagaagtggatgggattggatttggaagagcggatgatatcggacgtgcgttaggtata
tcgggtaatcacgacgaccgtgtacgcgcgggatgtttttatacgttagagaatgtatca
ttacaacttggtcacgtttatatgagaaaagatcaacttataagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgacagaggaagacattataagctgtattgaaatgatg
cagagtgaagggaaagtcatcatcgaagaagagcgagtatatttggcatcgttattctat
tctgaaaaaggtgttgtaaagtctattcgcaggctcatgaatcaggaagaaacaccttca
tttcctgaagcagaagtgttaaagacgttaggtgaaattgaagaacaattgaacgtacag
tatgcaccgcttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acgggtggaccgggaacgggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatatagtgatgataatccatttccgata
ctattaacagctccaacaggaagagcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgcacaattcaccgtttacttggctggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggcgat
gaagatcaattaccatctgtaggacctgggcaagtattgaaagatttattaaatgcaggt
gcagttccaacagtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtgatt
caacttgcccatgcgataaaaaatggaacgctcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaggttattaagaaggtttgc
gaaaacgctaagacaaaagggtttagcgcaagagatgtacaagtattggccccgatgtat
cgtggaccggctggtattaatgtactaaacgaagcgttgcaagaagtttttaatccgaaa
agagaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtt
ttgcaactcgttaatcagccggagagccaagtatttaatggtgatatcggtgaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcttattgctgt
tccattcataaatcgcaaggtagtgagtttcccattgtgattatgccgatagtgaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgcttttcagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagccgcttgcaagaatcacaaggagaagtacagatggta
acggttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system