KEGG   Bacillus cereus F837/76: bcf_22325Help
Entry
bcf_22325         CDS       T01703                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bcf  Bacillus cereus F837/76
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4228610..4229362)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIAGQLHSYDW
VIFTSKNGVAFFLDSLRKKLPVTTKIAAVGVKTKLELEKRGYHVDFVPTSFVAEVFAEEF
VKRLSGNERILFPKGNLAREVIPVALREIGVSLDELIVYGTKVNIEKKQELIAALKLGKV
DIITFTSPSTVTSFVRLLDGTNWREWTKKCTIACIGPITEKEASLYFPHVIMPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggcaaaacggtattgattacacgtgcccagcaccaagcaaaacaa
atgagtgtagcggtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gagggtatgtctcataggcaaattcaacatatagcagggcagttacattcgtatgactgg
gttatttttacgagtaaaaatggggtagctttttttctagattctttgagaaagaagctc
cccgtaacgactaaaattgctgcagtaggcgtgaaaacaaagttagagttagaaaagcga
ggctatcatgtagactttgttccaacttcatttgttgcagaagtatttgcagaagagttt
gtaaaaagattaagtggaaacgaacgtattttatttccgaaagggaatttagcaagagag
gtaattccggttgcacttcgggaaattggtgtttctctagatgagctaatcgtatacggt
acgaaagtgaatatagaaaaaaagcaagagcttatagcagcattgaagttagggaaagta
gacattattacatttacgagcccttcaactgttactagttttgttcgtttacttgatggt
acaaactggagagaatggacaaaaaaatgtacaattgcttgtatagggcctattacggaa
aaagaggcgagcctttattttccgcatgttattatgccgaaagagtacactgtagaagca
ttactacaatgcgtttgtgaatctataaaataa

DBGET integrated database retrieval system