KEGG   Bacillus cereus F837/76: bcf_22640Help
Entry
bcf_22640         CDS       T01703                                 

Definition
Enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcf  Bacillus cereus F837/76
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bcf01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bcf00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4289392..4290168)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcacggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgtggaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacgactcgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaatctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcgtttttagaaaaacgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system