KEGG   Bacillus cereus F837/76: bcf_23305Help
Entry
bcf_23305         CDS       T01703                                 

Definition
(GenBank) Acyl-coenzyme A synthetases/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00010  Glycolysis / Gluconeogenesis
bcf00620  Pyruvate metabolism
bcf00640  Propanoate metabolism
bcf00680  Methane metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_23305
   00620 Pyruvate metabolism
    bcf_23305
   00640 Propanoate metabolism
    bcf_23305
  Energy metabolism
   00680 Methane metabolism
    bcf_23305
Enzymes [BR:bcf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     bcf_23305
Lipid biosynthesis proteins [BR:bcf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   bcf_23305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW57780
Position
complement(4411294..4412880)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKGKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGVVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQRHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGIP
VQVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaaggaaaattagctttaatttggcaagatgataaagggaatcgccga
gaagttacatacgctgagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaaaggggacaagcttctcattatgatgccacgcttaattgaagcgtac
atgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaaatgttg
cgcaaaaaggatatcgaatatcgcattggccacggggaagtaaaagcaattgtaagttat
gagccgtacattggacagtttgatgatatagaagcgatggaatctcttcaaaaattcgtt
ctgagcgagcagtcagtagatggatggattaatttaaaaacagcgttagaaacagagagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacaggaaatccaaaaggtgttgttcatacgcatgcgtgggcatacgctcattta
cgtacaagcgctccaaattggcttggaattgaagagaatgatgttgtatgggcaacagct
agtccaggctggcagaagtggatttggagcccatttttagcaactctcggatcaggagcg
acaggagttgtataccacggtaaatttgaaccgaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccgactgagtatagattaatggcaaaagtagaa
aatttaagtgagtacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaggcactttcatattacagtgagagacggctat
ggacaaacggaaaatacattgctcgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccaacgccaggcaaccacgttgatattgtaaatgaggaaggtattccg
gtacaggtaggagaagttggtgatatcgcagttcacattgaaacgccagccctctttaaa
caatactataaagacgatgagcgcacagcgatgcaattccgaggtgattattatattacc
ggtgataaagcgaagaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggctatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttatgtaagagaatgtgcagttgttgcaagccctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaagaacttactgcaccatataaataccctcgtaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system