KEGG   Bacillus cereus F837/76: bcf_23405Help
Entry
bcf_23405         CDS       T01703                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00010  Glycolysis / Gluconeogenesis
bcf00620  Pyruvate metabolism
bcf00640  Propanoate metabolism
bcf00680  Methane metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_23405
   00620 Pyruvate metabolism
    bcf_23405
   00640 Propanoate metabolism
    bcf_23405
  Energy metabolism
   00680 Methane metabolism
    bcf_23405
Enzymes [BR:bcf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     bcf_23405
Lipid biosynthesis proteins [BR:bcf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   bcf_23405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: AEW57800
Position
complement(4430962..4432680)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPAMMRGIW
NNKQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSEELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtaaatatggcgtatgaagcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagccctttattatcaagatggatctcgaaaagagaagtatacatttaaggaaatgaag
gatttttctaataaagcaggaaacgtcctaaaaaactatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccgcgttctccagagttatatttcgcacttcttggtgcagtg
aaattgggagcaattgttggtccactatttgaagcatttatggaaggcgcagttcgcgat
cgtttagaagatagcgaagcaaaagtgttaattacaacacctgaattgttagagcgtgta
ccattaaatgatttacctgctttaaaaacagtcttccttgttggagataatgtagaagaa
ggcggtaaaacagtagcattcaatcctttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattttacattacacgtctggttctactggtaag
ccgaaaggtgtgcttcatgcgcaaaacgccatggttcagcactatcaaacggcgaaatgg
gtattagatttaaaagaagacgatgtatattggtgcacagctgacccaggctgggtaacg
ggaacagcttacggtatttttgcaccgtggttagtcggagcatcaaatgttattttaggc
ggacgctttagtccagaagcgtggtatgaagcactgcaagattacggtgtaacagtttgg
tacagcgcaccaacagcgttccgtatgttaatgggtgccggacaagatgcaattaaaaaa
tatgatttatcacaagtacgccacgtgttgagcgttggtgaaccgttaaatccagaagta
attcgctggggtatgaacgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgccacca
tacacaatgggtaacttagcaattggtaaaggttggccagcgatgatgcgtggaatttgg
aataacaagcaaaagtatgagtcttactttatgccgggcgattggtacgtatcaggtgac
tctgcctatatggacgaggatggatacttctggttccaagggcgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtggaaagcaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccagtgcgcggagaaatcattaaa
gcatttatcgcgcttcgagcaggatacgaaccatctgaagaattaaaagaagaaattcgt
caatttgtaaagaaaggtctagcagctcatgcagcgccaagacaaattgaatttagagat
aaattaccgaaaacgagaagcggtaaaattatgcgccgcgtattaaaagcgtgggagtta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system