KEGG   Bacillus cereus F837/76: bcf_24660Help
Entry
bcf_24660         CDS       T01703                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00040  Pentose and glucuronate interconversions
bcf00052  Galactose metabolism
bcf00500  Starch and sucrose metabolism
bcf00520  Amino sugar and nucleotide sugar metabolism
bcf01100  Metabolic pathways
bcf01130  Biosynthesis of antibiotics
Module
bcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bcf_24660
   00052 Galactose metabolism
    bcf_24660
   00500 Starch and sucrose metabolism
    bcf_24660
   00520 Amino sugar and nucleotide sugar metabolism
    bcf_24660
Enzymes [BR:bcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bcf_24660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEW58026
Position
complement(4650128..4651015)
Genome map
AA seq 295 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILEEQTNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacattcac
tatattcgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaattc
atcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaacaa
catgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaaatt
caacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaatcgaaatggcactacaacacccagaattacgtgatgacatggtc
gtaatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system