KEGG   Bacillus cereus F837/76: bcf_25580Help
Entry
bcf_25580         CDS       T01703                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bcf  Bacillus cereus F837/76
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4828166..4828909)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLAYTTPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKERDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctacacttgtcatgcgccaatttataaagggcacggtgtcccaccagaagag
cttgttcatacaggtcctgaagattggtggcaagacgtaacagaggcatatcagctttta
aaagataaaggttttgagaaaattgctgttgttggtttatctttaggtggagtattttct
ttaaaattagcgtatacaacaccggttttaggtgtagtaccaatgtgtgcaccgatgtat
attaagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaag
cgtgagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatg
atttatgcgccaacatttgttgtacaagcacgtcatgatgaaatgattaatacagatagt
gcgaacattatttataacggtgtagaatctacgttaaaagacattaaatggtatgaagac
tctacacatgtcattacacttgataaagagcgtgacgagctacatgaggatgtatataac
tttctggagcaactagattggtaa

DBGET integrated database retrieval system