KEGG   Bacillus cereus F837/76: bcf_25615Help
Entry
bcf_25615         CDS       T01703                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00010  Glycolysis / Gluconeogenesis
bcf00051  Fructose and mannose metabolism
bcf00562  Inositol phosphate metabolism
bcf01100  Metabolic pathways
bcf01110  Biosynthesis of secondary metabolites
bcf01120  Microbial metabolism in diverse environments
bcf01130  Biosynthesis of antibiotics
bcf01200  Carbon metabolism
bcf01230  Biosynthesis of amino acids
Module
bcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcf_M00002  Glycolysis, core module involving three-carbon compounds
bcf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bcf_25615
   00051 Fructose and mannose metabolism
    bcf_25615
   00562 Inositol phosphate metabolism
    bcf_25615
Enzymes [BR:bcf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bcf_25615
Exosome [BR:bcf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bcf_25615
  Exosomal proteins of bladder cancer cells
   bcf_25615
  Exosomal proteins of melanoma cells
   bcf_25615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW58217
Position
complement(4834582..4835337)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEVSPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaagttagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactattgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gcggctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system