KEGG   Bacillus cereus G9842: BCG9842_B0420Help
Entry
BCG9842_B0420     CDS       T00815                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcg  Bacillus cereus G9842
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcg01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcg00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4629406..4630812)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGEAE
GFASKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGESTIEGNTVTLQIKGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDILGEKATIAYKDEISGPLTVNVGRLSYTKENGGNLGLNVRYPVTTNFEE
TIAKLKEYVGTHGFEVADYSNSRPHHVDKDHVLIRTLQCVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagagggcgca
ccattcggtgaaggggtagaaaaagcgctatctttcatgttacataaaggagaagctgaa
ggttttgcttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cccgcatatagtgcggatattcgcgatggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttcaaaacgtgttcgtatgattataggaacagatgaagaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcaccagatgcagatttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgacgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggggaatcgactatagaaggtaatacagtg
acgttgcaaataaaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttgactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatattttgggtgaaaaagctactattgct
tataaagatgaaattagcggtccgttaacagtgaatgttggtcgcctttcttatacgaaa
gaaaacggtggtaacttagggctaaacgtacgttacccagttacaactaactttgaagaa
acaattgcgaagttgaaagagtatgttggtacgcatggatttgaagtagctgactattct
aattcacgcccgcatcacgttgataaagaccacgtattaattcgtacgttacaatgtgta
tatgaagaacaaacaggtgaaaaagcagaactattagcaattggcggaggtacttatgct
cgttcattaaaagctggtgtggcatttggaccgctattccctggaaaggaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcaatttatgcg
caagcaattcatgaattagcgaagtaa

DBGET integrated database retrieval system