KEGG   Bacillus cereus G9842: BCG9842_B0464Help
Entry
BCG9842_B0464     CDS       T00815                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00620  Pyruvate metabolism
bcg00640  Propanoate metabolism
bcg00680  Methane metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B0464 (acsA)
   00620 Pyruvate metabolism
    BCG9842_B0464 (acsA)
   00640 Propanoate metabolism
    BCG9842_B0464 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B0464 (acsA)
Enzymes [BR:bcg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCG9842_B0464 (acsA)
Lipid biosynthesis proteins [BR:bcg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCG9842_B0464 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: ACK96894
UniProt: B7IKS7
Position
complement(4589863..4591581)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLREDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIAKGWPSMMRGIW
NNQQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtaaatatggcgtatgaggcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagctctttattatcaagatggatcgcgaaaagagaaatatacatttaaggaaatgaag
gatttttctaataaagcaggaaatgtcctgaaaaattatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccacgttctccagaattatatttcgcacttttaggtgcagtg
aaattaggagcaattgttggaccgttatttgaagcatttatggaaggtgcggttcgcgat
cgtttagaagatagtgaagcgaaggtgttaattacaacgcctgagttattagagcgtgta
ccattaaatgatttacctgctttaaaaacagtttttcttgttggagataatgtagaagaa
ggcggtaaaacggtagcgttcaatcctttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagatggtttaattcttcactatacgtctggttctactggtaag
ccaaaaggtgtgcttcatgcgcaaaatgcaatggttcagcactatcaaacggcgaaatgg
gtattagatttaagagaagacgatgtatattggtgcacagctgatccaggctgggtaacg
ggaactgcttacggtattttcgcaccgtggttagttggagcgtcaaatgttattttaggt
gggcgatttagtccggaagcttggtatgaagcactgcaagattacggtgtaacagtttgg
tatagtgcaccgacagcgttccgtatgttaatgggagctggacaagacgcaattaaaaaa
tatgacttatcacaagttcgtcacgtattaagcgttggtgagccgttaaatccagaagta
attcgctggggtatgaatgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aaacccattccaggtgtaaaagcagcgattgttgataatgaaggaaatgaagttcctcca
tacacaatgggtaacttagcaattgcgaaaggttggccatctatgatgcgcgggatctgg
aataaccagcaaaagtatgaatcttatttcatgccgggagattggtacgtatcaggtgac
tctgcctatatggatgaagatggatacttctggttccaaggacgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtagaaagtaaattaatcgagcatgct
gctgttgcagaagcaggtgtaattggtattcctgatccagtgcgtggcgaaattattaaa
gcatttatcgcacttcgagcaggatacgaaccatctgatgaattaaaagaagaaattcgt
caatttgtaaagaaaggcctagcagctcatgcagcgccacgacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagctg
aatttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system